PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa10g010910.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 530aa    MW: 59414.5 Da    PI: 6.9494
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa10g010910.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B339.78.9e-13401091396
                     TT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3  13 sgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                      + l+l  +f+++h ++        + d s r+W+vkl  ++++    l++GW++F+ ++g k+gD++vFk++g++    +v+v
  Csa10g010910.1  40 DDGLTLDAEFLRNHTKV------FLISDASDRVWKVKL--DGGR----LADGWEKFAGEHGFKDGDVLVFKHHGDEVL--HVSV 109
                     56788899999888655......67779**********..9998....***********************8886555..7766 PP

2B358.99.3e-191792641198
                     HHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3  11 lksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                      +s+r+ l++kf++ +g ++ +  ++ + +e+gr W++kl  + +sg +++++GW++F++ n+L++gDf+ Fkl +  ++++v++++ 
  Csa10g010910.1 179 IASARIDLSRKFTAFFG-EHLKACEIDVINEQGRIWTMKLAKNTSSGVFYIRAGWEHFCSTNDLRQGDFCKFKLFQ-IGERPVLSLCP 264
                     6788999*****97773.4456669***************88888888*************************977.55667877775 PP

3B363.24e-20299392799
                     .-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE......EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3   7 psdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliy....rkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                     +++   +g+l+lp +f++e+g++k++  +++l d++gr+W+ +l++    r  s++++l+kGW+e+++ ng+k++D++ ++l++ +++++++k++
  Csa10g010910.1 299 TPSRDYTGQLSLPVSFTRENGINKAG--DVILLDQDGRKWSSYLQItglgRDVSEWFYLRKGWREMCEPNGVKVNDSFKLELMW-EGANPLFKFC 390
                     566667789**************888..7***************998998888899****************************.9999*****9 PP

                     -S CS
              B3  98 rk 99 
                     +k
  Csa10g010910.1 391 SK 392
                     87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086311.12428113IPR003340B3 DNA binding domain
SMARTSM010194.1E-1133113IPR003340B3 DNA binding domain
CDDcd100174.85E-937109No hitNo description
PfamPF023621.1E-742108IPR003340B3 DNA binding domain
SuperFamilySSF1019362.16E-1149109IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.7E-1152109IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.294169265IPR003340B3 DNA binding domain
SMARTSM010191.0E-15175266IPR003340B3 DNA binding domain
CDDcd100171.10E-17178264No hitNo description
PfamPF023623.2E-15180264IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.3E-14182265IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.73E-16183266IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.4E-17290392IPR015300DNA-binding pseudobarrel domain
CDDcd100179.26E-15292391No hitNo description
SMARTSM010191.1E-21293393IPR003340B3 DNA binding domain
PROSITE profilePS5086312.026293392IPR003340B3 DNA binding domain
PfamPF023629.6E-21296392IPR003340B3 DNA binding domain
SuperFamilySSF1019369.42E-18297397IPR015300DNA-binding pseudobarrel domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 530 aa     Download sequence    Send to blast
MMYKAIKKGS HVVKTYSVIE SAFNNIGDDG FGYSTIINRD DGLTLDAEFL RNHTKVFLIS  60
DASDRVWKVK LDGGRLADGW EKFAGEHGFK DGDVLVFKHH GDEVLHVSVA PQSVSGNIHH  120
ASSSHIDTED TYIDDDDDND GEDEDDDDDD GAGDGARKNQ KQILHQATLV SSQDVLLVIA  180
SARIDLSRKF TAFFGEHLKA CEIDVINEQG RIWTMKLAKN TSSGVFYIRA GWEHFCSTND  240
LRQGDFCKFK LFQIGERPVL SLCPQESGNG HKEKRKLDEV SKRKEKKAAP SPTVIIKYTP  300
SRDYTGQLSL PVSFTRENGI NKAGDVILLD QDGRKWSSYL QITGLGRDVS EWFYLRKGWR  360
EMCEPNGVKV NDSFKLELMW EGANPLFKFC SKIENHEYKG KGNHTTSRKR ACKTSPQPRN  420
VRKTPRVGVE GQVNKRISRG PEHQVDEERG RTQVSNRTNT ISRKFLSVQP QSCSVSDQVA  480
SVKQGIVDTL NTVRQCRTEL ETSEQNLQAS LLAIDALGER IWGISNDLV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0038910.0BT003891.1 Arabidopsis thaliana clone RAFL15-10-H22 (R20619) unknown protein (At4g31610) mRNA, complete cds.
GenBankBT0050020.0BT005002.1 Arabidopsis thaliana clone U20619 unknown protein (At4g31610) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010438016.10.0PREDICTED: B3 domain-containing protein REM1-like
SwissprotQ84J390.0REM1_ARATH; B3 domain-containing protein REM1
TrEMBLR0F9690.0R0F969_9BRAS; Uncharacterized protein
STRINGAT4G31610.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM99501736
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31610.10.0B3 family protein